Recombinant Human HOXB4, GST-tagged
Cat.No. : | HOXB4-29378TH |
Product Overview : | Recombinant Human HOXB4(1 a.a. - 60 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion. |
Molecular Mass : | 32.34 kDa |
AA Sequence : | MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAAC |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXB4 homeobox B4 [ Homo sapiens (human) ] |
Official Symbol | HOXB4 |
Synonyms | HOXB4; homeobox B4; homeo box B4 , HOX2, HOX2F; homeobox protein Hox-B4; homeo box 2F; homeo box B4; homeobox protein Hox-2F; homeobox protein Hox-2.6; HOX2; HOX2F; HOX-2.6 |
Gene ID | 3214 |
mRNA Refseq | NM_024015 |
Protein Refseq | NP_076920 |
MIM | 142965 |
UniProt ID | P17483 |
Chromosome Location | 17q21.32 |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity |
◆ Recombinant Proteins | ||
HOXB4-1415H | Recombinant Human HOXB4 Protein (1-251 aa), His-tagged | +Inquiry |
HOXB4-3622H | Recombinant Human HOXB4 Protein (Met1-Leu251), N-His tagged | +Inquiry |
HOXB4-6845C | Recombinant Chicken HOXB4 | +Inquiry |
HOXB4-13898H | Recombinant Human HOXB4, GST-tagged | +Inquiry |
HOXB4-29378TH | Recombinant Human HOXB4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXB4-5423HCL | Recombinant Human HOXB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXB4 Products
Required fields are marked with *
My Review for All HOXB4 Products
Required fields are marked with *
0
Inquiry Basket