Recombinant Human HOXB4, GST-tagged

Cat.No. : HOXB4-29378TH
Product Overview : Recombinant Human HOXB4(1 a.a. - 60 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.
Molecular Mass : 32.34 kDa
AA Sequence : MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAAC
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXB4 homeobox B4 [ Homo sapiens (human) ]
Official Symbol HOXB4
Synonyms HOXB4; homeobox B4; homeo box B4 , HOX2, HOX2F; homeobox protein Hox-B4; homeo box 2F; homeo box B4; homeobox protein Hox-2F; homeobox protein Hox-2.6; HOX2; HOX2F; HOX-2.6
Gene ID 3214
mRNA Refseq NM_024015
Protein Refseq NP_076920
MIM 142965
UniProt ID P17483
Chromosome Location 17q21.32
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXB4 Products

Required fields are marked with *

My Review for All HOXB4 Products

Required fields are marked with *

0
cart-icon
0
compare icon