Recombinant Human HOXB4, GST-tagged

• Cat.No.: HOXB4-29378TH
• Product Overview: Recombinant Human HOXB4(1 a.a. - 60 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.
• Molecular Mass: 32.34 kDa
• AA Sequence: MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAAC
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXB4 homeobox B4 [ Homo sapiens (human) ]
• Official Symbol: HOXB4
• Synonyms: HOXB4; homeobox B4; homeo box B4 , HOX2, HOX2F; homeobox protein Hox-B4; homeo box 2F; homeo box B4; homeobox protein Hox-2F; homeobox protein Hox-2.6; HOX2; HOX2F; HOX-2.6
• Gene ID: 3214
• mRNA Refseq: NM_024015
• Protein Refseq: NP_076920
• MIM: 142965
• UniProt ID: P17483
• Chromosome Location: 17q21.32
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity