"HOXD1" Related Products

Recombinant Human HOXD1

Cat.No.: HOXD1-26895TH
Product Overview: Recombinant fragment of Human HOXD1 with N terminal proprietary tag. Predicted MW 35.53 kDa.
Description: This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
Sequence Similarities: Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name: HOXD1 homeobox D1 [ Homo sapiens ]
Official Symbol: HOXD1
Synonyms: HOXD1; homeobox D1; homeo box D1 , HOX4, HOX4G; homeobox protein Hox-D1;
Gene ID: 3231
mRNA Refseq: NM_024501
Protein Refseq: NP_078777
MIM: 142987
Uniprot ID: Q9GZZ0
Chromosome Location: 2q31.1
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.