Recombinant Human HOXD1

Cat.No. : HOXD1-26895TH
Product Overview : Recombinant fragment of Human HOXD1 with N terminal proprietary tag. Predicted MW 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
Sequence Similarities : Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name HOXD1 homeobox D1 [ Homo sapiens ]
Official Symbol HOXD1
Synonyms HOXD1; homeobox D1; homeo box D1 , HOX4, HOX4G; homeobox protein Hox-D1;
Gene ID 3231
mRNA Refseq NM_024501
Protein Refseq NP_078777
MIM 142987
Uniprot ID Q9GZZ0
Chromosome Location 2q31.1
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXD1 Products

Required fields are marked with *

My Review for All HOXD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon