Recombinant Human HOXD1
| Cat.No. : | HOXD1-26895TH |
| Product Overview : | Recombinant fragment of Human HOXD1 with N terminal proprietary tag. Predicted MW 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ |
| Sequence Similarities : | Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain. |
| Gene Name | HOXD1 homeobox D1 [ Homo sapiens ] |
| Official Symbol | HOXD1 |
| Synonyms | HOXD1; homeobox D1; homeo box D1 , HOX4, HOX4G; homeobox protein Hox-D1; |
| Gene ID | 3231 |
| mRNA Refseq | NM_024501 |
| Protein Refseq | NP_078777 |
| MIM | 142987 |
| Uniprot ID | Q9GZZ0 |
| Chromosome Location | 2q31.1 |
| Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| HOXD1-26895TH | Recombinant Human HOXD1 | +Inquiry |
| HOXD1-3731HF | Recombinant Full Length Human HOXD1 Protein, GST-tagged | +Inquiry |
| HOXD1-4988H | Recombinant Human HOXD1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOXD1-5413HCL | Recombinant Human HOXD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXD1 Products
Required fields are marked with *
My Review for All HOXD1 Products
Required fields are marked with *



