Recombinant Human HOXD1
Cat.No. : | HOXD1-26895TH |
Product Overview : | Recombinant fragment of Human HOXD1 with N terminal proprietary tag. Predicted MW 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ |
Sequence Similarities : | Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXD1 homeobox D1 [ Homo sapiens ] |
Official Symbol | HOXD1 |
Synonyms | HOXD1; homeobox D1; homeo box D1 , HOX4, HOX4G; homeobox protein Hox-D1; |
Gene ID | 3231 |
mRNA Refseq | NM_024501 |
Protein Refseq | NP_078777 |
MIM | 142987 |
Uniprot ID | Q9GZZ0 |
Chromosome Location | 2q31.1 |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HOXD1-3731HF | Recombinant Full Length Human HOXD1 Protein, GST-tagged | +Inquiry |
HOXD1-4988H | Recombinant Human HOXD1 Protein, GST-tagged | +Inquiry |
HOXD1-26895TH | Recombinant Human HOXD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXD1-5413HCL | Recombinant Human HOXD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXD1 Products
Required fields are marked with *
My Review for All HOXD1 Products
Required fields are marked with *
0
Inquiry Basket