"HOXD8" Related Products

Expand

Recombinant Human HOXD8

Cat.No.: HOXD8-26896TH
Product Overview: Recombinant fragment of Human HOXD8 with N-terminal proprietary tag. Predicted MW 32.78kDa.
Description: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5 end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. Alternate splicing results in multiple transcript variants.
Protein length: 65 amino acids
Molecular Weight: 32.780kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR
Sequence Similarities: Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: HOXD8 homeobox D8 [ Homo sapiens ]
Official Symbol: HOXD8
Synonyms: HOXD8; homeobox D8; homeo box D8 , HOX4, HOX4E; homeobox protein Hox-D8;
Gene ID: 3234
mRNA Refseq: NM_001199746
Protein Refseq: NP_001186675
MIM: 142985
Uniprot ID: P13378
Chromosome Location: 2q31.1
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.