Recombinant Human HOXD8

Cat.No. : HOXD8-26896TH
Product Overview : Recombinant fragment of Human HOXD8 with N-terminal proprietary tag. Predicted MW 32.78kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 65 amino acids
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5 end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. Alternate splicing results in multiple transcript variants.
Molecular Weight : 32.780kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR
Sequence Similarities : Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXD8 homeobox D8 [ Homo sapiens ]
Official Symbol HOXD8
Synonyms HOXD8; homeobox D8; homeo box D8 , HOX4, HOX4E; homeobox protein Hox-D8;
Gene ID 3234
mRNA Refseq NM_001199746
Protein Refseq NP_001186675
MIM 142985
Uniprot ID P13378
Chromosome Location 2q31.1
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXD8 Products

Required fields are marked with *

My Review for All HOXD8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon