Recombinant Human HOXD8
Cat.No. : | HOXD8-26896TH |
Product Overview : | Recombinant fragment of Human HOXD8 with N-terminal proprietary tag. Predicted MW 32.78kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 65 amino acids |
Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5 end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. Alternate splicing results in multiple transcript variants. |
Molecular Weight : | 32.780kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR |
Sequence Similarities : | Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXD8 homeobox D8 [ Homo sapiens ] |
Official Symbol | HOXD8 |
Synonyms | HOXD8; homeobox D8; homeo box D8 , HOX4, HOX4E; homeobox protein Hox-D8; |
Gene ID | 3234 |
mRNA Refseq | NM_001199746 |
Protein Refseq | NP_001186675 |
MIM | 142985 |
Uniprot ID | P13378 |
Chromosome Location | 2q31.1 |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HOXD8-7820M | Recombinant Mouse HOXD8 Protein | +Inquiry |
HOXD8-7117C | Recombinant Chicken HOXD8 | +Inquiry |
HOXD8-4999H | Recombinant Human HOXD8 Protein, GST-tagged | +Inquiry |
HOXD8-26896TH | Recombinant Human HOXD8 | +Inquiry |
HOXD8-3737HF | Recombinant Full Length Human HOXD8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXD8-5410HCL | Recombinant Human HOXD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXD8 Products
Required fields are marked with *
My Review for All HOXD8 Products
Required fields are marked with *
0
Inquiry Basket