"HSD11B1" Related Products

Expand
Expand

Recombinant Human HSD11B1

Cat.No.: HSD11B1-27736TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-292 of Human HSD11B1, with an N-terminal proprietary tag, predicted MWt 57.86 kDa
Description: The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.
Protein length: 292 amino acids
Molecular Weight: 57.860kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed. Highest expression in liver.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVT GASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE LGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ SNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY STSYNMDRFINK
Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name: HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ]
Official Symbol: HSD11B1
Synonyms: HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1;
Gene ID: 3290
mRNA Refseq: NM_001206741
Protein Refseq: NP_001193670
MIM: 600713
Uniprot ID: P28845
Chromosome Location: 1q32-q41
Pathway: Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone, organism-specific biosystem; C21-Steroid hormone biosynthesis, progesterone =>
Function: 11-beta-hydroxysteroid dehydrogenase (NADP+) activity; 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity; nucleotide binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.