"HTATIP2" Related Products

Expand
Expand

Recombinant Human HTATIP2, His-tagged

Cat.No.: HTATIP2-30679TH
Product Overview: Recombinant full length Human TIP30 protein with an N terminal His tag; 262 amino acids ; predicted mwt: 29.3 kDa.
Description: Oxidoreductase HTATIP2 is an enzyme that in humans is encoded by the HTATIP2 gene. It may be a metastasis suppressor.
Protein length: 242 amino acids
Conjugation: HIS
Molecular Weight: 29.300kDa inclusive of tags
Source: E. coli
Tissue specificity: Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Gene Name: HTATIP2 HIV-1 Tat interactive protein 2, 30kDa [ Homo sapiens ]
Official Symbol: HTATIP2
Synonyms: HTATIP2; HIV-1 Tat interactive protein 2, 30kDa; HIV 1 Tat interactive protein 2, 30 kDa; oxidoreductase HTATIP2; CC3; FLJ26963; SDR44U1; short chain dehydrogenase/reductase family 44U; member 1; Tat interacting protein (30kD); TIP30;
Gene ID: 10553
mRNA Refseq: NM_001098523
Protein Refseq: NP_001091993
MIM: 605628
Uniprot ID: Q9BUP3
Chromosome Location: 11p15.1
Function: NAD binding; oxidoreductase activity; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor; protein binding; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.