Recombinant Human IFIT1

• Cat.No.: IFIT1-26949TH
• Product Overview: Recombinant fragment of Human IFIT1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa inclusive of tag.

Specification

• Description: Interferon-induced Protein With Tetratricopeptide Repeats 1 is a protein that is encoded by the IFIT1 gene.
• Protein length: 103 amino acids
• Molecular Weight: 36.960kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHR KAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVN AIIHYLKAIKIEQASLTRDKSIN
• Sequence Similarities: Belongs to the IFIT family.Contains 10 TPR repeats.

Gene Information

• Gene Name: IFIT1 interferon-induced protein with tetratricopeptide repeats 1 [ Homo sapiens ]
• Official Symbol: IFIT1
• Synonyms: IFIT1; interferon-induced protein with tetratricopeptide repeats 1; G10P1, IFI56, IFNAI1; GARG 16
• Gene ID: 3434
• mRNA Refseq: NM_001548
• Protein Refseq: NP_001539
• MIM: 147690
• Uniprot ID: P09914
• Chromosome Location: 10q23.31
• Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem
• Function: protein binding