"IFIT1" Related Products

Recombinant Human IFIT1

Cat.No.: IFIT1-26949TH
Product Overview: Recombinant fragment of Human IFIT1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa inclusive of tag.
Description: Interferon-induced Protein With Tetratricopeptide Repeats 1 is a protein that is encoded by the IFIT1 gene.
Protein length: 103 amino acids
Molecular Weight: 36.960kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHR KAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVN AIIHYLKAIKIEQASLTRDKSIN
Sequence Similarities: Belongs to the IFIT family.Contains 10 TPR repeats.
Gene Name: IFIT1 interferon-induced protein with tetratricopeptide repeats 1 [ Homo sapiens ]
Official Symbol: IFIT1
Synonyms: IFIT1; interferon-induced protein with tetratricopeptide repeats 1; G10P1, IFI56, IFNAI1; GARG 16;
Gene ID: 3434
mRNA Refseq: NM_001548
Protein Refseq: NP_001539
MIM: 147690
Uniprot ID: P09914
Chromosome Location: 10q23.31
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.