Recombinant Human IFIT1
Cat.No. : | IFIT1-26949TH |
Product Overview : | Recombinant fragment of Human IFIT1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 103 amino acids |
Description : | Interferon-induced Protein With Tetratricopeptide Repeats 1 is a protein that is encoded by the IFIT1 gene. |
Molecular Weight : | 36.960kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHR KAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVN AIIHYLKAIKIEQASLTRDKSIN |
Sequence Similarities : | Belongs to the IFIT family.Contains 10 TPR repeats. |
Gene Name | IFIT1 interferon-induced protein with tetratricopeptide repeats 1 [ Homo sapiens ] |
Official Symbol | IFIT1 |
Synonyms | IFIT1; interferon-induced protein with tetratricopeptide repeats 1; G10P1, IFI56, IFNAI1; GARG 16; |
Gene ID | 3434 |
mRNA Refseq | NM_001548 |
Protein Refseq | NP_001539 |
MIM | 147690 |
Uniprot ID | P09914 |
Chromosome Location | 10q23.31 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
IFIT1-48P | Recombinant P. alecto IFIT1 Protein, His-tagged | +Inquiry |
IFIT1-8014M | Recombinant Mouse IFIT1 Protein | +Inquiry |
IFIT1-4432M | Recombinant Mouse IFIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFIT1-630HFL | Recombinant Full Length Human IFIT1 Protein, C-Flag-tagged | +Inquiry |
IFIT1-26949TH | Recombinant Human IFIT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFIT1-5288HCL | Recombinant Human IFIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFIT1 Products
Required fields are marked with *
My Review for All IFIT1 Products
Required fields are marked with *
0
Inquiry Basket