Recombinant Human IFIT1

Cat.No. : IFIT1-26949TH
Product Overview : Recombinant fragment of Human IFIT1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 103 amino acids
Description : Interferon-induced Protein With Tetratricopeptide Repeats 1 is a protein that is encoded by the IFIT1 gene.
Molecular Weight : 36.960kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHR KAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVN AIIHYLKAIKIEQASLTRDKSIN
Sequence Similarities : Belongs to the IFIT family.Contains 10 TPR repeats.
Gene Name IFIT1 interferon-induced protein with tetratricopeptide repeats 1 [ Homo sapiens ]
Official Symbol IFIT1
Synonyms IFIT1; interferon-induced protein with tetratricopeptide repeats 1; G10P1, IFI56, IFNAI1; GARG 16;
Gene ID 3434
mRNA Refseq NM_001548
Protein Refseq NP_001539
MIM 147690
Uniprot ID P09914
Chromosome Location 10q23.31
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFIT1 Products

Required fields are marked with *

My Review for All IFIT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon