Recombinant Human IK, His-tagged
Cat.No. : | IK-31311TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 312-557 of Human RED with an N terminal His tag; Predicted MWt 30 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene was identified by its RED repeat, a stretch of repeated arginine, glutamic acid and aspartic acid residues. The protein localizes to discrete dots within the nucleus, excluding the nucleolus. Its function is unknown. This gene maps to chromosome 5; however, a pseudogene may exist on chromosome 2. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 110 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRERD RDRDRERERERDRERERERDREREEEKKRHSYFEKPKV DDEPMDVDKGPGSTKELIKSINEKFAGSAGWEGTESLK KPEDKKQLGDFFGMSNSYAECYPATMDDMAVDSDEEVD YSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQ YGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRK KMEADGVEVKRPKY |
Gene Name : | IK IK cytokine, down-regulator of HLA II [ Homo sapiens ] |
Official Symbol : | IK |
Synonyms : | IK; IK cytokine, down-regulator of HLA II; protein Red; |
Gene ID : | 3550 |
mRNA Refseq : | NM_006083 |
Protein Refseq : | NP_006074 |
MIM : | 600549 |
Uniprot ID : | Q13123 |
Chromosome Location : | 5q31.3 |
Products Types
◆ Recombinant Protein | ||
IK-2045R | Recombinant Rhesus Macaque IK Protein, His (Fc)-Avi-tagged | +Inquiry |
IK-2674R | Recombinant Rat IK Protein, His (Fc)-Avi-tagged | +Inquiry |
IK-4484M | Recombinant Mouse IK Protein, His (Fc)-Avi-tagged | +Inquiry |
IK-3411H | Recombinant Human IK Protein (Met1-Pro192), N-GST tagged | +Inquiry |
IK-1512H | Recombinant Human IK protein, His & GST-tagged | +Inquiry |
◆ Lysates | ||
IK-343HCL | Recombinant Human IK lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket