"IL2RB" Related Products

Expand
Expand

Recombinant Human IL2RB, Fc-tagged

Cat.No.: IL2RB-29776TH
Product Overview: Recombinant fragment, corresponding to amino acids 27-237 of Human IL2 Receptor beta fused to the Fc region of human IgG1 expressed in modified human 293 cells.
Description: The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein.
Conjugation: Fc
Biological activity: IL2RB-29776TH bound to protein A sepharose beads is able to pull down its ligand, IL2.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence:AVNGTSQFTCFYNSRANISCVWSQDGALQ DTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAP DSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLR LMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVR VKPLQGEFTTWSPWSQPLAFRTKPAALGIPKVDKKVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene Name: IL2RB interleukin 2 receptor, beta [ Homo sapiens ]
Official Symbol: IL2RB
Synonyms: IL2RB; interleukin 2 receptor, beta; IL15RB, interleukin 15 receptor, beta; interleukin-2 receptor subunit beta; CD122;
Gene ID: 3560
mRNA Refseq: NM_000878
Protein Refseq: NP_000869
MIM: 146710
Uniprot ID: P14784
Chromosome Location: 22q13
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; Endocytosis, organism-specific biosystem;
Function: interleukin-2 binding; interleukin-2 receptor activity; contributes_to interleukin-2 receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.