"IMMT" Related Products

Expand
Expand

Recombinant Human IMMT, His-tagged

Cat.No.: IMMT-30241TH
Product Overview: Recombinant fragment, corresponding to amino acids 378-747 of Human Mitofilin with N terminal His tag; 370 amino acids, 47kDa.
Description: Mitochondrial inner membrane protein is a protein that in humans is encoded by the IMMT gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 59 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VSDLADKLSTDDLNSLIAHAHRRIDQLNRELAEQKATEKQ HITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDR KIEEVRDAMENEMRTQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYA RLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKT SSAETPTIPLGSAVEAIKANCSDNEFTQALTAAIPPESLT RGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFL SYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCI EHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIV EILTAYASAVGIGTTQVQPE
Gene Name: IMMT inner membrane protein, mitochondrial [ Homo sapiens ]
Official Symbol: IMMT
Synonyms: IMMT; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); mitochondrial inner membrane protein; HMP; MINOS2; mitochondrial inner membrane organizing system 2; mitofilin; P87; P89;
Gene ID: 10989
mRNA Refseq: NM_001100169
Protein Refseq: NP_001093639
MIM: 600378
Uniprot ID: Q16891
Chromosome Location: 2p11.2
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.