Recombinant Human IMMT protein, GST-tagged

• Cat.No.: IMMT-839H
• Product Overview: Recombinant Human IMMT(481 a.a. - 580 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 481-580 a.a.
• Description: Mitochondrial inner membrane protein is a protein that in humans is encoded by the IMMT gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQS HAVAEEEARKAHQLWLSVEALKYSM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: IMMT inner membrane protein, mitochondrial [ Homo sapiens ]
• Official Symbol: IMMT
• Synonyms: IMMT; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); mitochondrial inner membrane protein; HMP; MINOS2; mitochondrial inner membrane organizing system 2; mitofilin; P87; P89; motor protein; proliferation-inducing gene 4; cell proliferation-inducing protein 52; cell proliferation-inducing gene 4/52 protein; PIG4; PIG52; P87/89; MGC111146; DKFZp779P1653
• Gene ID: 10989
• mRNA Refseq: NM_006839
• Protein Refseq: NP_006830
• MIM: 600378
• UniProt ID: Q16891
• Chromosome Location: 2p11.2
• Function: protein binding