"IPO5" Related Products

Recombinant Human IPO5

Cat.No.: IPO5-27548TH
Product Overview: Recombinant fragment of Human Karyopherin beta 3 with N-terminal proprietary tag. Predicted MW 36.63kDa.
Description: Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME
Sequence Similarities: Belongs to the importin beta family.Contains 6 HEAT repeats.Contains 1 importin N-terminal domain.
Gene Name: IPO5 importin 5 [ Homo sapiens ]
Official Symbol: IPO5
Synonyms: IPO5; importin 5; karyopherin (importin) beta 3 , KPNB3, RAN binding protein 5 , RANBP5; importin-5; IMB3; MGC2068;
Gene ID: 3843
mRNA Refseq: NM_002271
Protein Refseq: NP_002262
MIM: 602008
Uniprot ID: O00410
Chromosome Location: 13q32.2
Pathway: Influenza Infection, organism-specific biosystem; Influenza Life Cycle, organism-specific biosystem; Influenza Viral RNA Transcription and Replication, organism-specific biosystem; vRNP Assembly, organism-specific biosystem;
Function: GTPase inhibitor activity; Ran GTPase binding; protein binding; protein transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.