Recombinant Human IPO5
Cat.No. : | IPO5-27548TH |
Product Overview : | Recombinant fragment of Human Karyopherin beta 3 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME |
Sequence Similarities : | Belongs to the importin beta family.Contains 6 HEAT repeats.Contains 1 importin N-terminal domain. |
Gene Name | IPO5 importin 5 [ Homo sapiens ] |
Official Symbol | IPO5 |
Synonyms | IPO5; importin 5; karyopherin (importin) beta 3 , KPNB3, RAN binding protein 5 , RANBP5; importin-5; IMB3; MGC2068; |
Gene ID | 3843 |
mRNA Refseq | NM_002271 |
Protein Refseq | NP_002262 |
MIM | 602008 |
Uniprot ID | O00410 |
Chromosome Location | 13q32.2 |
Pathway | Influenza Infection, organism-specific biosystem; Influenza Life Cycle, organism-specific biosystem; Influenza Viral RNA Transcription and Replication, organism-specific biosystem; vRNP Assembly, organism-specific biosystem; |
Function | GTPase inhibitor activity; Ran GTPase binding; protein binding; protein transporter activity; |
◆ Recombinant Proteins | ||
IPO5-2335H | Recombinant Human IPO5 Protein, His-tagged | +Inquiry |
IPO5-27548TH | Recombinant Human IPO5 | +Inquiry |
IPO5-4581M | Recombinant Mouse IPO5 Protein, His (Fc)-Avi-tagged | +Inquiry |
IPO5-8264M | Recombinant Mouse IPO5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IPO5-1467HCL | Recombinant Human IPO5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IPO5 Products
Required fields are marked with *
My Review for All IPO5 Products
Required fields are marked with *
0
Inquiry Basket