Recombinant Human IPO5 protein, His-tagged

• Cat.No.: IPO5-4563H
• Product Overview: Recombinant Human IPO5 protein(22-150 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 22-150 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: IPO5 importin 5 [ Homo sapiens ]
• Official Symbol: IPO5
• Synonyms: IPO5; importin 5; karyopherin (importin) beta 3 , KPNB3, RAN binding protein 5 , RANBP5; importin-5; IMB3; MGC2068; Pse1; karyopherin beta-3; RAN binding protein 5; ran-binding protein 5; importin beta-3 subunit; importin subunit beta-3; Ran_GTP binding protein 5; karyopherin (importin) beta 3; imp5; KPNB3; RANBP5; FLJ43041; DKFZp686O1576
• Gene ID: 3843
• mRNA Refseq: NM_002271
• Protein Refseq: NP_002262
• MIM: 602008
• UniProt ID: O00410