Recombinant Human IPO5 protein, His-tagged
Cat.No. : | IPO5-4563H |
Product Overview : | Recombinant Human IPO5 protein(22-150 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-150 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | IPO5 importin 5 [ Homo sapiens ] |
Official Symbol | IPO5 |
Synonyms | IPO5; importin 5; karyopherin (importin) beta 3 , KPNB3, RAN binding protein 5 , RANBP5; importin-5; IMB3; MGC2068; Pse1; karyopherin beta-3; RAN binding protein 5; ran-binding protein 5; importin beta-3 subunit; importin subunit beta-3; Ran_GTP binding protein 5; karyopherin (importin) beta 3; imp5; KPNB3; RANBP5; FLJ43041; DKFZp686O1576; |
Gene ID | 3843 |
mRNA Refseq | NM_002271 |
Protein Refseq | NP_002262 |
MIM | 602008 |
UniProt ID | O00410 |
◆ Recombinant Proteins | ||
IPO5-4563H | Recombinant Human IPO5 protein, His-tagged | +Inquiry |
IPO5-4581M | Recombinant Mouse IPO5 Protein, His (Fc)-Avi-tagged | +Inquiry |
IPO5-27548TH | Recombinant Human IPO5 | +Inquiry |
IPO5-8264M | Recombinant Mouse IPO5 Protein | +Inquiry |
IPO5-2335H | Recombinant Human IPO5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IPO5-1467HCL | Recombinant Human IPO5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IPO5 Products
Required fields are marked with *
My Review for All IPO5 Products
Required fields are marked with *