Recombinant Human IPO5 protein, His-tagged

Cat.No. : IPO5-4563H
Product Overview : Recombinant Human IPO5 protein(22-150 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 22-150 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name IPO5 importin 5 [ Homo sapiens ]
Official Symbol IPO5
Synonyms IPO5; importin 5; karyopherin (importin) beta 3 , KPNB3, RAN binding protein 5 , RANBP5; importin-5; IMB3; MGC2068; Pse1; karyopherin beta-3; RAN binding protein 5; ran-binding protein 5; importin beta-3 subunit; importin subunit beta-3; Ran_GTP binding protein 5; karyopherin (importin) beta 3; imp5; KPNB3; RANBP5; FLJ43041; DKFZp686O1576;
Gene ID 3843
mRNA Refseq NM_002271
Protein Refseq NP_002262
MIM 602008
UniProt ID O00410

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IPO5 Products

Required fields are marked with *

My Review for All IPO5 Products

Required fields are marked with *

0
cart-icon
0
compare icon