"ITGB7" Related Products

Expand

Recombinant Human ITGB7

Cat.No.: ITGB7-26863TH
Product Overview: Recombinant fragment corresponding to amino acids 401-505 of Human Integrin beta 7 with an N terminl proproetary tag; predicted mwt: 37.18 kDa.
Description: Integrin beta-7 is a protein that in humans is encoded by the ITGB7 gene.
Protein length: 105 amino acids
Molecular Weight: 37.180kDa
Source: Wheat germ
Tissue specificity: Expressed in a variety of leukocyte lines.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFW VSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD TQPQAPHCSDGQGHLQCGVCSCAPG
Sequence Similarities: Belongs to the integrin beta chain family.Contains 1 VWFA domain.
Gene Name: ITGB7 integrin, beta 7 [ Homo sapiens ]
Official Symbol: ITGB7
Synonyms: ITGB7; integrin, beta 7; integrin beta-7;
Gene ID: 3695
mRNA Refseq: NM_000889
Protein Refseq: NP_000880
MIM: 147559
Uniprot ID: P26010
Chromosome Location: 12q13.1
Pathway: Adaptive Immune System, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function: binding; metal ion binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.