Recombinant Human ITGB7

• Cat.No.: ITGB7-26863TH
• Product Overview: Recombinant fragment corresponding to amino acids 401-505 of Human Integrin beta 7 with an N terminl proproetary tag; predicted mwt: 37.18 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 105 amino acids
• Description: Integrin beta-7 is a protein that in humans is encoded by the ITGB7 gene.
• Molecular Weight: 37.180kDa
• Tissue specificity: Expressed in a variety of leukocyte lines.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFW VSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD TQPQAPHCSDGQGHLQCGVCSCAPG
• Sequence Similarities: Belongs to the integrin beta chain family.Contains 1 VWFA domain.

Gene Information

• Gene Name: ITGB7 integrin, beta 7 [ Homo sapiens ]
• Official Symbol: ITGB7
• Synonyms: ITGB7; integrin, beta 7; integrin beta-7
• Gene ID: 3695
• mRNA Refseq: NM_000889
• Protein Refseq: NP_000880
• MIM: 147559
• Uniprot ID: P26010
• Chromosome Location: 12q13.1
• Pathway: Adaptive Immune System, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem
• Function: binding; metal ion binding; receptor activity