Recombinant Human ITGB7 protein(1-140aa), GST-tagged
Cat.No. : | ITGB7-1861H |
Product Overview : | Recombinant Human ITGB7 protein(P26010)(1-140aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-140aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL |
Gene Name | ITGB7 integrin, beta 7 [ Homo sapiens ] |
Official Symbol | ITGB7 |
Synonyms | ITGB7; integrin, beta 7; integrin beta-7; integrin beta 7 subunit; gut homing receptor beta subunit; |
Gene ID | 3695 |
mRNA Refseq | NM_000889 |
Protein Refseq | NP_000880 |
MIM | 147559 |
UniProt ID | P26010 |
◆ Recombinant Proteins | ||
ITGB7-1861H | Recombinant Human ITGB7 protein(1-140aa), GST-tagged | +Inquiry |
RFL24511HF | Recombinant Full Length Human Integrin Beta-7(Itgb7) Protein, His-Tagged | +Inquiry |
ITGB7-1417HFL | Recombinant Full Length Human ITGB7 Protein, C-Flag-tagged | +Inquiry |
ITGB7-4966H | Recombinant Human ITGB7 Protein, GST-tagged | +Inquiry |
RFL7279MF | Recombinant Full Length Mouse Integrin Beta-7(Itgb7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB7-5121HCL | Recombinant Human ITGB7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB7 Products
Required fields are marked with *
My Review for All ITGB7 Products
Required fields are marked with *