Recombinant Human ITGB7 protein(1-140aa), GST-tagged

• Cat.No.: ITGB7-1861H
• Product Overview: Recombinant Human ITGB7 protein(P26010)(1-140aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-140aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL

Gene Information

• Gene Name: ITGB7 integrin, beta 7 [ Homo sapiens ]
• Official Symbol: ITGB7
• Synonyms: ITGB7; integrin, beta 7; integrin beta-7; integrin beta 7 subunit; gut homing receptor beta subunit
• Gene ID: 3695
• mRNA Refseq: NM_000889
• Protein Refseq: NP_000880
• MIM: 147559
• UniProt ID: P26010