Recombinant Human ITGB7
Cat.No. : | ITGB7-26863TH |
Product Overview : | Recombinant fragment corresponding to amino acids 401-505 of Human Integrin beta 7 with an N terminl proproetary tag; predicted mwt: 37.18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 105 amino acids |
Description : | Integrin beta-7 is a protein that in humans is encoded by the ITGB7 gene. |
Molecular Weight : | 37.180kDa |
Tissue specificity : | Expressed in a variety of leukocyte lines. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFW VSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD TQPQAPHCSDGQGHLQCGVCSCAPG |
Sequence Similarities : | Belongs to the integrin beta chain family.Contains 1 VWFA domain. |
Gene Name | ITGB7 integrin, beta 7 [ Homo sapiens ] |
Official Symbol | ITGB7 |
Synonyms | ITGB7; integrin, beta 7; integrin beta-7; |
Gene ID | 3695 |
mRNA Refseq | NM_000889 |
Protein Refseq | NP_000880 |
MIM | 147559 |
Uniprot ID | P26010 |
Chromosome Location | 12q13.1 |
Pathway | Adaptive Immune System, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
Function | binding; metal ion binding; receptor activity; |
◆ Recombinant Proteins | ||
ITGB7-4966H | Recombinant Human ITGB7 Protein, GST-tagged | +Inquiry |
ITGB7-26863TH | Recombinant Human ITGB7 | +Inquiry |
ITGB7-1587H | Recombinant Human ITGB7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ITGB7-260HF | Recombinant Full Length Human ITGB7 Protein | +Inquiry |
ITGB7-1218H | Recombinant Human ITGB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB7-5121HCL | Recombinant Human ITGB7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB7 Products
Required fields are marked with *
My Review for All ITGB7 Products
Required fields are marked with *
0
Inquiry Basket