Recombinant Human ITGB7
| Cat.No. : | ITGB7-26863TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 401-505 of Human Integrin beta 7 with an N terminl proproetary tag; predicted mwt: 37.18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 105 amino acids |
| Description : | Integrin beta-7 is a protein that in humans is encoded by the ITGB7 gene. |
| Molecular Weight : | 37.180kDa |
| Tissue specificity : | Expressed in a variety of leukocyte lines. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFW VSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD TQPQAPHCSDGQGHLQCGVCSCAPG |
| Sequence Similarities : | Belongs to the integrin beta chain family.Contains 1 VWFA domain. |
| Gene Name | ITGB7 integrin, beta 7 [ Homo sapiens ] |
| Official Symbol | ITGB7 |
| Synonyms | ITGB7; integrin, beta 7; integrin beta-7; |
| Gene ID | 3695 |
| mRNA Refseq | NM_000889 |
| Protein Refseq | NP_000880 |
| MIM | 147559 |
| Uniprot ID | P26010 |
| Chromosome Location | 12q13.1 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
| Function | binding; metal ion binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| RFL24511HF | Recombinant Full Length Human Integrin Beta-7(Itgb7) Protein, His-Tagged | +Inquiry |
| ITGB7-1861H | Recombinant Human ITGB7 protein(1-140aa), GST-tagged | +Inquiry |
| ITGB7-4966H | Recombinant Human ITGB7 Protein, GST-tagged | +Inquiry |
| Itgb7-3611M | Recombinant Mouse Itgb7 Protein, Myc/DDK-tagged | +Inquiry |
| ITGB7-26863TH | Recombinant Human ITGB7 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB7-5121HCL | Recombinant Human ITGB7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB7 Products
Required fields are marked with *
My Review for All ITGB7 Products
Required fields are marked with *
