Recombinant Human KAT2A, His-tagged
Cat.No. : | KAT2A-29886TH |
Product Overview : | Recombinant full length Human KAT2A / GCN5 with an N termianl His tag; 477 amino acids with the tag; predicted MWt: 51.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 427 amino acids |
Description : | KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al. |
Conjugation : | HIS |
Molecular Weight : | 51.100kDa inclusive of tags |
Tissue specificity : | Expressed in all tissues tested, with most abundant expression in ovary. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.08% DTT, 40% Glycerol, 1.17% Sodium chloride, 0.03% EDTA, 0.32% Tris HCl |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK |
Sequence Similarities : | Belongs to the GCN5 family.Contains 1 bromo domain.Contains 1 N-acetyltransferase domain. |
Gene Name | KAT2A K(lysine) acetyltransferase 2A [ Homo sapiens ] |
Official Symbol | KAT2A |
Synonyms | KAT2A; K(lysine) acetyltransferase 2A; GCN5 general control of amino acid synthesis 5 like 2 (yeast) , GCN5L2; histone acetyltransferase KAT2A; GCN5; PCAF b; |
Gene ID | 2648 |
mRNA Refseq | NM_021078 |
Protein Refseq | NP_066564 |
MIM | 602301 |
Uniprot ID | Q92830 |
Chromosome Location | 17q12-q21 |
Pathway | C-MYC pathway, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; |
Function | H3 histone acetyltransferase activity; N-acetyltransferase activity; chromatin binding; histone acetyltransferase activity; contributes_to histone acetyltransferase activity; |
◆ Recombinant Proteins | ||
KAT2A-679HF | Recombinant Full Length Human KAT2A Protein, GST-tagged | +Inquiry |
KAT2A-2129H | Recombinant Human K(lysine) Acetyltransferase 2A, His-tagged | +Inquiry |
KAT2A-29886TH | Recombinant Human KAT2A, His-tagged | +Inquiry |
KAT2A-5764H | Recombinant Human KAT2A protein, His-tagged | +Inquiry |
KAT2A-120H | Recombinant Human KAT2A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KAT2A-290HCL | Recombinant Human KAT2A HEK293T cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KAT2A Products
Required fields are marked with *
My Review for All KAT2A Products
Required fields are marked with *