Recombinant Human KAT2A, His-tagged

Cat.No. : KAT2A-29886TH
Product Overview : Recombinant full length Human KAT2A / GCN5 with an N termianl His tag; 477 amino acids with the tag; predicted MWt: 51.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 427 amino acids
Description : KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al.
Conjugation : HIS
Molecular Weight : 51.100kDa inclusive of tags
Tissue specificity : Expressed in all tissues tested, with most abundant expression in ovary.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.08% DTT, 40% Glycerol, 1.17% Sodium chloride, 0.03% EDTA, 0.32% Tris HCl
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Sequence Similarities : Belongs to the GCN5 family.Contains 1 bromo domain.Contains 1 N-acetyltransferase domain.
Gene Name KAT2A K(lysine) acetyltransferase 2A [ Homo sapiens ]
Official Symbol KAT2A
Synonyms KAT2A; K(lysine) acetyltransferase 2A; GCN5 general control of amino acid synthesis 5 like 2 (yeast) , GCN5L2; histone acetyltransferase KAT2A; GCN5; PCAF b;
Gene ID 2648
mRNA Refseq NM_021078
Protein Refseq NP_066564
MIM 602301
Uniprot ID Q92830
Chromosome Location 17q12-q21
Pathway C-MYC pathway, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; HTLV-I infection, organism-specific biosystem;
Function H3 histone acetyltransferase activity; N-acetyltransferase activity; chromatin binding; histone acetyltransferase activity; contributes_to histone acetyltransferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KAT2A Products

Required fields are marked with *

My Review for All KAT2A Products

Required fields are marked with *

0
cart-icon