Recombinant Human KLRD1

Cat.No. : KLRD1-26330TH
Product Overview : Recombinant full length Human CD94 with N-terminal proprietary tag. Predicted MW 45.1kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 179 amino acids
Description : Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene.
Molecular Weight : 45.100kDa inclusive of tags
Tissue specificity : Natural killer cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSI EPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQK TWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLS YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGN ALDESCEDKNRYICKQQLI
Sequence Similarities : Contains 1 C-type lectin domain.
Gene Name KLRD1 killer cell lectin-like receptor subfamily D, member 1 [ Homo sapiens ]
Official Symbol KLRD1
Synonyms KLRD1; killer cell lectin-like receptor subfamily D, member 1; CD94; natural killer cells antigen CD94;
Gene ID 3824
mRNA Refseq NM_001114396
Protein Refseq NP_001107868
MIM 602894
Uniprot ID Q13241
Chromosome Location 12p13
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Graft-versus-host disease, organism-specific biosystem; Graft-versus-host disease, conserved biosystem;
Function binding; receptor activity; sugar binding; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRD1 Products

Required fields are marked with *

My Review for All KLRD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon