"KLRD1" Related Products

Expand
Expand

Recombinant Human KLRD1

Cat.No.: KLRD1-26330TH
Product Overview: Recombinant full length Human CD94 with N-terminal proprietary tag. Predicted MW 45.1kDa.
Description: Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene.
Protein length: 179 amino acids
Molecular Weight: 45.100kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Natural killer cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSI EPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQK TWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLS YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGN ALDESCEDKNRYICKQQLI
Sequence Similarities: Contains 1 C-type lectin domain.
Gene Name: KLRD1 killer cell lectin-like receptor subfamily D, member 1 [ Homo sapiens ]
Official Symbol: KLRD1
Synonyms: KLRD1; killer cell lectin-like receptor subfamily D, member 1; CD94; natural killer cells antigen CD94;
Gene ID: 3824
mRNA Refseq: NM_001114396
Protein Refseq: NP_001107868
MIM: 602894
Uniprot ID: Q13241
Chromosome Location: 12p13
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Graft-versus-host disease, organism-specific biosystem; Graft-versus-host disease, conserved biosystem;
Function: binding; receptor activity; sugar binding; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.