Recombinant Human KRT6B KRT6B-29910TH

Recombinant Human KRT6B

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human KRT6B

Recombinant Human KRT6B

KRT6B Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : KRT6B-29910TH
Product Overview : Recombinant full length Human KRT6B with N-terminal proprietary tag. Mol Wt 87.78 kDa inclusive of tag.
Description : The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. Mutations in these genes have been associated with pachyonychia congenita. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Protein length : 564 amino acids
Molecular Weight : 87.780kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Constitutively expressed in distinct types of epithelia such as those in oral mucosa, esophagus, papillae of tongue and hair follicle outer root sheath.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSR SRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAIS GGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVR AEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQE QGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELR NMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMN KVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVL SMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY EELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKK QCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQD LARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSG LGVGGGFSSSSGRATGGGLSSVGGGSSTIKYTTTSSSSRK SYKH
Sequence Similarities : Belongs to the intermediate filament family.
Gene Name : KRT6B keratin 6B [ Homo sapiens ]
Official Symbol : KRT6B
Synonyms : KRT6B; keratin 6B; keratin like 1 (a type II keratin sequence) , KRTL1; keratin, type II cytoskeletal 6B;
Gene ID : 3854
mRNA Refseq : NM_005555
Protein Refseq : NP_005546
MIM : 148042
Uniprot ID : P04259
Chromosome Location : 12q13.13
Function : structural constituent of cytoskeleton;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy