"L1CAM" Related Products

Expand
Expand
Expand

Recombinant Human L1CAM, His-tagged

Cat.No.: L1CAM-26864TH
Product Overview: Recombinant fragment, corresponding to amino acids 605-1065 of Human L1CAM with an N-terminal His tag; MWt 53 kDa.
Description: The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of a neuron-specific exon is thought to be functionally relevant.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 58 μl aqua dest
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: (Amino acid sequence (Sequence determined by 5 Sequencing))QLLVVGSPGPVPRLVLSDLHLLTQSQ VRVSWSPAEDHNAPIEKYDIEFEDKEMAPEKWYSLGKV PGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVDVKGEGNETTNMVITWKPLRWMDWNAP QVQYRVQWRPQGTRGPWQEQIVSDPFLVVSNTSTFVPY EIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIE ILNSSAVLVKWRPVDLAQVKGHLRGYNVTYWREGSQRK HSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNG RGSGPASEFTFSTPEGVPGHPEALHLECQSNTSLLLRW QPPLSHNGVLTGYVLSYHPLDEGGKGQLSFNLRDPELR THNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMAL SGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKAL GEEKGGASLSP
Sequence Similarities: Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.Contains 5 fibronectin type-III domains.Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name: L1CAM L1 cell adhesion molecule [ Homo sapiens ]
Official Symbol: L1CAM
Synonyms: L1CAM; L1 cell adhesion molecule; antigen identified by monoclonal R1 , HSAS, HSAS1, MASA, MIC5, S10, SPG1; neural cell adhesion molecule L1; CD171;
Gene ID: 3897
mRNA Refseq: NM_000425
Protein Refseq: NP_000416
MIM: 308840
Uniprot ID: P32004
Chromosome Location: Xq28
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem;
Function: PDZ domain binding; identical protein binding; integrin binding; protein self-association; sialic acid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.