"LEPRE1" Related Products

Expand

Recombinant Human LEPRE1, His-tagged

Cat.No.: LEPRE1-29940TH
Product Overview: Recombinant fragment, corresponding to amino acids 322-736 of Human LEPRE1 with N terminal His tag; 415 amino acids, 52kDa.
Description: This gene encodes an enzyme that is a member of the collagen prolyl hydroxylase family. These enzymes are localized to the endoplasmic reticulum and their activity is required for proper collagen synthesis and assembly. Mutations in this gene are associated with osteogenesis imperfecta type VIII. Three alternatively spliced transcript variants encoding different isoforms have been described. Other variants may exist, but their biological validity has not been determined.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 143 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ECAKTYLLFFPNDEVMNQNLAYYAAMLGEEHTRSIGPRES AKEYRQRSLLEKELLFFAYDVFGIPFVDPDSWTPEEVI PKRLQEKQKSERETAVRISQEIGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEGISLTMNSKLLNGSQRVVMDGV ISDHECQELQRLTNVAATSGDGYRGQTSPHTPNEKFYG VTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIMESYFRLDTPLYFSYSHLVCRTAIEEVQAERKDDSHPVHVDNCIL NAETLVCVKEPPAYTFRDYSAILYLNGDFDGGNFYFTE LDAKTVTAEVQPQCGRAVGFSSGTENPHGVKAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKMLFSPEEMDLSQEQ PLDAQQGPPEPAQESLSGSESKPKDEL
Gene Name: LEPRE1 leucine proline-enriched proteoglycan (leprecan) 1 [ Homo sapiens ]
Official Symbol: LEPRE1
Synonyms: LEPRE1; leucine proline-enriched proteoglycan (leprecan) 1; prolyl 3-hydroxylase 1; GROS1; growth suppressor 1; LEPRECAN; MGC117314; P3H1; prolyl 3 hydroxylase 1;
Gene ID: 64175
mRNA Refseq: NM_001146289
Protein Refseq: NP_001139761
MIM: 610339
Uniprot ID: Q32P28
Chromosome Location: 1p34.1
Function: L-ascorbic acid binding; binding; iron ion binding; metal ion binding; molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.