"LIAS" Related Products

Expand

Recombinant Human LIAS, His-tagged

Cat.No.: LIAS-27755TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-372 of Human LIAS, with N terminal His tag; 372 amino acids, 43kDa.
Description: The protein encoded by this gene belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 129 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQ NGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPP WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGE CWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPP LDASEPYNTAKAIAEWGLDYVVLTSVDRDDMPDGGAEH IAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLD VYAHNVETVPELQSKVRDPRANFDQSLRVLKHAKKVQP DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQ YMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASG PLVRSSYKAGEFFLKNLVAKRKTKDL
Gene Name: LIAS lipoic acid synthetase [ Homo sapiens ]
Official Symbol: LIAS
Synonyms: LIAS; lipoic acid synthetase; lipoyl synthase, mitochondrial; LAS;
Gene ID: 11019
mRNA Refseq: NM_006859
Protein Refseq: NP_006850
MIM: 607031
Uniprot ID: O43766
Chromosome Location: 4p14
Pathway: Lipoic acid metabolism, organism-specific biosystem; Lipoic acid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: 4 iron, 4 sulfur cluster binding; lipoate synthase activity; metal ion binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.