"LLGL1" Related Products

Expand

Recombinant Human LLGL1

Cat.No.: LLGL1-28095TH
Product Overview: Recombinant fragment of Human Lgl1 with an N terminal proprietary tag; Predicted MW 36.63 kDa.
Description: This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in brain, kidney, and muscle but is barely seen in heart and placenta. Down-regulated or lost in all cell lines and in most of the tumor samples analyzed. Loss was associated with advanced stage of the disease.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP
Sequence Similarities: Belongs to the WD repeat L(2)GL family.Contains 14 WD repeats.
Gene Name: LLGL1 lethal giant larvae homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol: LLGL1
Synonyms: LLGL1; lethal giant larvae homolog 1 (Drosophila); DLG4, HUGL, HUGL 1, lethal giant larvae (Drosophila) homolog 1 , LLGL; lethal(2) giant larvae protein homolog 1;
Gene ID: 3996
mRNA Refseq: NM_004140
Protein Refseq: NP_004131
MIM: 600966
Uniprot ID: Q15334
Chromosome Location: 17p11.2
Pathway: Tight junction, organism-specific biosystem; Tight junction, conserved biosystem;
Function: protein binding; protein kinase binding; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.