Recombinant Human LLGL1
| Cat.No. : | LLGL1-28095TH |
| Product Overview : | Recombinant fragment of Human Lgl1 with an N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Expressed in brain, kidney, and muscle but is barely seen in heart and placenta. Down-regulated or lost in all cell lines and in most of the tumor samples analyzed. Loss was associated with advanced stage of the disease. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP |
| Sequence Similarities : | Belongs to the WD repeat L(2)GL family.Contains 14 WD repeats. |
| Gene Name | LLGL1 lethal giant larvae homolog 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | LLGL1 |
| Synonyms | LLGL1; lethal giant larvae homolog 1 (Drosophila); DLG4, HUGL, HUGL 1, lethal giant larvae (Drosophila) homolog 1 , LLGL; lethal(2) giant larvae protein homolog 1; |
| Gene ID | 3996 |
| mRNA Refseq | NM_004140 |
| Protein Refseq | NP_004131 |
| MIM | 600966 |
| Uniprot ID | Q15334 |
| Chromosome Location | 17p11.2 |
| Pathway | Tight junction, organism-specific biosystem; Tight junction, conserved biosystem; |
| Function | protein binding; protein kinase binding; structural molecule activity; |
| ◆ Recombinant Proteins | ||
| LLGL1-4410Z | Recombinant Zebrafish LLGL1 | +Inquiry |
| LLGL1-5106M | Recombinant Mouse LLGL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LLGL1-28095TH | Recombinant Human LLGL1 | +Inquiry |
| LLGL1-3422R | Recombinant Rat LLGL1 Protein | +Inquiry |
| LLGL1-3078R | Recombinant Rat LLGL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LLGL1 Products
Required fields are marked with *
My Review for All LLGL1 Products
Required fields are marked with *
