Recombinant Human LLGL1

• Cat.No.: LLGL1-28095TH
• Product Overview: Recombinant fragment of Human Lgl1 with an N terminal proprietary tag; Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed in brain, kidney, and muscle but is barely seen in heart and placenta. Down-regulated or lost in all cell lines and in most of the tumor samples analyzed. Loss was associated with advanced stage of the disease.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP
• Sequence Similarities: Belongs to the WD repeat L(2)GL family.Contains 14 WD repeats.

Gene Information

• Gene Name: LLGL1 lethal giant larvae homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: LLGL1
• Synonyms: LLGL1; lethal giant larvae homolog 1 (Drosophila); DLG4, HUGL, HUGL 1, lethal giant larvae (Drosophila) homolog 1 , LLGL; lethal(2) giant larvae protein homolog 1
• Gene ID: 3996
• mRNA Refseq: NM_004140
• Protein Refseq: NP_004131
• MIM: 600966
• Uniprot ID: Q15334
• Chromosome Location: 17p11.2
• Pathway: Tight junction, organism-specific biosystem; Tight junction, conserved biosystem
• Function: protein binding; protein kinase binding; structural molecule activity