"LLGL2" Related Products

Recombinant Human LLGL2

Cat.No.: LLGL2-29145TH
Product Overview: Recombinant fragment of Human LLGL2 with N terminal proprietary tag, 36.52 kDa.
Description: The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the proteins ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
Sequence Similarities: Belongs to the WD repeat L(2)GL family.Contains 14 WD repeats.
Gene Name: LLGL2 lethal giant larvae homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol: LLGL2
Synonyms: LLGL2; lethal giant larvae homolog 2 (Drosophila); lethal giant larvae (Drosophila) homolog 2; lethal(2) giant larvae protein homolog 2; HGL;
Gene ID: 3993
mRNA Refseq: NM_001015002
Protein Refseq: NP_001015002
Uniprot ID: Q6P1M3
Chromosome Location: 17q25.1
Pathway: Tight junction, organism-specific biosystem; Tight junction, conserved biosystem;
Function: PDZ domain binding; protein binding;
Products Types ◆ Recombinant Protein

◆ Lysates

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.