Recombinant Human LLGL2
| Cat.No. : | LLGL2-29145TH | 
| Product Overview : | Recombinant fragment of Human LLGL2 with N terminal proprietary tag, 36.52 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 99 amino acids | 
| Description : | The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the proteins ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms. | 
| Molecular Weight : | 36.520kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR | 
| Sequence Similarities : | Belongs to the WD repeat L(2)GL family.Contains 14 WD repeats. | 
| Gene Name | LLGL2 lethal giant larvae homolog 2 (Drosophila) [ Homo sapiens ] | 
| Official Symbol | LLGL2 | 
| Synonyms | LLGL2; lethal giant larvae homolog 2 (Drosophila); lethal giant larvae (Drosophila) homolog 2; lethal(2) giant larvae protein homolog 2; HGL; | 
| Gene ID | 3993 | 
| mRNA Refseq | NM_001015002 | 
| Protein Refseq | NP_001015002 | 
| Uniprot ID | Q6P1M3 | 
| Chromosome Location | 17q25.1 | 
| Pathway | Tight junction, organism-specific biosystem; Tight junction, conserved biosystem; | 
| Function | PDZ domain binding; protein binding; | 
| ◆ Recombinant Proteins | ||
| Llgl2-3795M | Recombinant Mouse Llgl2 Protein, Myc/DDK-tagged | +Inquiry | 
| LLGL2-5733H | Recombinant Human LLGL2 protein, His-tagged | +Inquiry | 
| LLGL2-11861Z | Recombinant Zebrafish LLGL2 | +Inquiry | 
| LLGL2-29145TH | Recombinant Human LLGL2 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| LLGL2-4720HCL | Recombinant Human LLGL2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LLGL2 Products
Required fields are marked with *
My Review for All LLGL2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            