Recombinant Human LLGL2
Cat.No. : | LLGL2-29145TH |
Product Overview : | Recombinant fragment of Human LLGL2 with N terminal proprietary tag, 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the proteins ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR |
Sequence Similarities : | Belongs to the WD repeat L(2)GL family.Contains 14 WD repeats. |
Gene Name | LLGL2 lethal giant larvae homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | LLGL2 |
Synonyms | LLGL2; lethal giant larvae homolog 2 (Drosophila); lethal giant larvae (Drosophila) homolog 2; lethal(2) giant larvae protein homolog 2; HGL; |
Gene ID | 3993 |
mRNA Refseq | NM_001015002 |
Protein Refseq | NP_001015002 |
Uniprot ID | Q6P1M3 |
Chromosome Location | 17q25.1 |
Pathway | Tight junction, organism-specific biosystem; Tight junction, conserved biosystem; |
Function | PDZ domain binding; protein binding; |
◆ Recombinant Proteins | ||
LLGL2-11861Z | Recombinant Zebrafish LLGL2 | +Inquiry |
LLGL2-5733H | Recombinant Human LLGL2 protein, His-tagged | +Inquiry |
LLGL2-29145TH | Recombinant Human LLGL2 | +Inquiry |
Llgl2-3795M | Recombinant Mouse Llgl2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LLGL2-4720HCL | Recombinant Human LLGL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LLGL2 Products
Required fields are marked with *
My Review for All LLGL2 Products
Required fields are marked with *