"MAD2L1" Related Products

Expand

Recombinant Human MAD2L1, His-tagged

Cat.No.: MAD2L1-28857TH
Product Overview: Recombinant full length Human Mad2L1 with an N terminal His tag ; mwt: 25.7 kDa.
Description: MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate.MAD2L1 is related to the MAD2L2 gene located on chromosome 1.A MAD2 pseudogene has been mapped to chromosome 14.
Protein length: 205 amino acids
Conjugation: HIS
Molecular Weight: 25.700kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Sequence Similarities: Belongs to the MAD2 family.Contains 1 HORMA domain.
Gene Name: MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) [ Homo sapiens ]
Official Symbol: MAD2L1
Synonyms: MAD2L1; MAD2 mitotic arrest deficient-like 1 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 1; mitotic spindle assembly checkpoint protein MAD2A; HSMAD2; MAD2;
Gene ID: 4085
mRNA Refseq: NM_002358
Protein Refseq: NP_002349
MIM: 601467
Uniprot ID: Q13257
Chromosome Location: 4q27
Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Amplificationof signal from unattachedkinetochores via a MAD2inhibitory signal, organism-specific biosystem; Amplification of signal from the kinetochores, organism-specific biosystem;
Function: protein binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.