Recombinant Human MAD2L1 protein, GST-tagged

• Cat.No.: MAD2L1-3686H
• Product Overview: Recombinant Human MAD2L1 protein(16-185 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 16-185 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: SAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) [ Homo sapiens ]
• Official Symbol: MAD2L1
• Synonyms: MAD2L1; MAD2 mitotic arrest deficient-like 1 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 1; mitotic spindle assembly checkpoint protein MAD2A; HSMAD2; MAD2; MAD2-like protein 1; mitotic arrest deficient 2-like protein 1; mitotic arrest deficient, yeast, homolog-like 1; MAD2 (mitotic arrest deficient, yeast, homolog)-like 1
• Gene ID: 4085
• mRNA Refseq: NM_002358
• Protein Refseq: NP_002349
• MIM: 601467
• UniProt ID: Q13257