Recombinant Human MAD2L1 protein, GST-tagged
Cat.No. : | MAD2L1-3686H |
Product Overview : | Recombinant Human MAD2L1 protein(16-185 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 16-185 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | SAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) [ Homo sapiens ] |
Official Symbol | MAD2L1 |
Synonyms | MAD2L1; MAD2 mitotic arrest deficient-like 1 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 1; mitotic spindle assembly checkpoint protein MAD2A; HSMAD2; MAD2; MAD2-like protein 1; mitotic arrest deficient 2-like protein 1; mitotic arrest deficient, yeast, homolog-like 1; MAD2 (mitotic arrest deficient, yeast, homolog)-like 1; |
Gene ID | 4085 |
mRNA Refseq | NM_002358 |
Protein Refseq | NP_002349 |
MIM | 601467 |
UniProt ID | Q13257 |
◆ Recombinant Proteins | ||
MAD2L1-2438R | Recombinant Rhesus Macaque MAD2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAD2L1-4408H | Recombinant Human MAD2L1 protein, His-SUMO-tagged | +Inquiry |
MAD2L1-6868H | Recombinant Human MAD2 Mitotic Arrest Deficient-Like 1 (yeast), His-tagged | +Inquiry |
MAD2L1-6599H | Recombinant Human MAD2L1 protein, His-tagged | +Inquiry |
MAD2L1-2618R | Recombinant Rhesus monkey MAD2L1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAD2L1-4570HCL | Recombinant Human MAD2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAD2L1 Products
Required fields are marked with *
My Review for All MAD2L1 Products
Required fields are marked with *