"MAPK11" Related Products

Expand
Expand
Expand

Recombinant Human MAPK11, His-tagged

Cat.No.: MAPK11-27606TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-364 of Human MAPK11, with an N-terminal His tag, 387aa, 43.8 kDa.
Description: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase.
Protein length: 364 amino acids
Conjugation: HIS
Molecular Weight: 43.800kDa inclusive of tags
Source: E. coli
Tissue specificity: Highest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMSGPRAGFYRQELNKTV WEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSR PFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIE DFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRG LKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADE EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELL QGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHART YIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRV SAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEW KELTYQEVLSFKPPEPPKPPGSLEIEQ
Sequence Similarities: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain.
Gene Name: MAPK11 mitogen-activated protein kinase 11 [ Homo sapiens ]
Official Symbol: MAPK11
Synonyms: MAPK11; mitogen-activated protein kinase 11; PRKM11; p38 2; p38Beta; SAPK2;
Gene ID: 5600
mRNA Refseq: NM_002751
Protein Refseq: NP_002742
MIM: 602898
Uniprot ID: Q15759
Chromosome Location: 22q13.33
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function: ATP binding; MAP kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.