Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human MAPK7

Cat.No. : MAPK7-26231TH
Product Overview : Recombinant fragment corresponding to amino acids 561-677 of Human ERK5 with an N terminal proprietary tag; Predicted MWt 38.5 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Molecular Weight : 38.500kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PQSSMSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGA GYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLA DWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
Sequence Similarities : Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain.
Gene Name : MAPK7 mitogen-activated protein kinase 7 [ Homo sapiens ]
Official Symbol : MAPK7
Synonyms : MAPK7; mitogen-activated protein kinase 7; PRKM7; BMK1; BMK1 kinase; ERK5; extracellular signal regulated kinase 5;
Gene ID : 5598
mRNA Refseq : NM_002749
Protein Refseq : NP_002740
MIM : 602521
Uniprot ID : Q13164
Chromosome Location : 17p11.2
Pathway : Activated TLR4 signalling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ERK/MAPK targets, organism-specific biosystem; ERKs are inactivated, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem;
Function : ATP binding; MAP kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends