"MARCH8" Related Products

Expand
Expand

Recombinant Human MARCH8

Cat.No.: MARCH8-26832TH
Product Overview: Recombinant Full Length Human MARCH8 produced in Saccharomyces cerevisiae; amino acids 1-291; 291 amino acids, MWt 32.9 kDa.
Description: MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al.
Tissue specificity: Broadly expressed. Present in immature dendritic cells (at protein level).
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLG HFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQD ICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIM CSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILE WPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNR VIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSD TNSSCCTEPEDTGAEIIHV
Sequence Similarities: Contains 1 RING-CH-type zinc finger.
Gene Name: MARCH8 membrane-associated ring finger (C3HC4) 8 [ Homo sapiens ]
Official Symbol: MARCH8
Synonyms: MARCH8; membrane-associated ring finger (C3HC4) 8; c mir, cellular modulator of immune recognition , MIR; E3 ubiquitin-protein ligase MARCH8; c MIR; MARCH VIII; RNF178;
Gene ID: 220972
mRNA Refseq: NM_001002265
Protein Refseq: NP_001002265
MIM: 613335
Uniprot ID: Q5T0T0
Chromosome Location: 10q11.22
Function: MHC class II protein binding; ligase activity; metal ion binding; ubiquitin-protein ligase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.