Recombinant Human MARCH8
Cat.No. : | MARCH8-26832TH |
Product Overview : | Recombinant Full Length Human MARCH8 produced in Saccharomyces cerevisiae; amino acids 1-291; 291 amino acids, MWt 32.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-291 a.a. |
Description : | MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al. |
Tissue specificity : | Broadly expressed. Present in immature dendritic cells (at protein level). |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLG HFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQD ICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIM CSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILE WPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNR VIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSD TNSSCCTEPEDTGAEIIHV |
Sequence Similarities : | Contains 1 RING-CH-type zinc finger. |
Full Length : | Full L. |
Gene Name | MARCH8 membrane-associated ring finger (C3HC4) 8 [ Homo sapiens ] |
Official Symbol | MARCH8 |
Synonyms | MARCH8; membrane-associated ring finger (C3HC4) 8; c mir, cellular modulator of immune recognition , MIR; E3 ubiquitin-protein ligase MARCH8; c MIR; MARCH VIII; RNF178; |
Gene ID | 220972 |
mRNA Refseq | NM_001002265 |
Protein Refseq | NP_001002265 |
MIM | 613335 |
Uniprot ID | Q5T0T0 |
Chromosome Location | 10q11.22 |
Function | MHC class II protein binding; ligase activity; metal ion binding; ubiquitin-protein ligase activity; zinc ion binding; |
◆ Cell & Tissue Lysates | ||
MARCH8-4469HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
MARCH8-4467HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
MARCH8-4468HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MARCH8 Products
Required fields are marked with *
My Review for All MARCH8 Products
Required fields are marked with *
0
Inquiry Basket