Recombinant Human MC4R
Cat.No. : | MC4R-29453TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-43 of Human MC4 Receptor with a proprietary tag; Predicted MWt 30.36 kDa including tag. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity. |
Protein length : | 43 amino acids |
Molecular Weight : | 30.360kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Brain, placental, and gut tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name : | MC4R melanocortin 4 receptor [ Homo sapiens ] |
Official Symbol : | MC4R |
Synonyms : | MC4R; melanocortin 4 receptor; melanocortin receptor 4; |
Gene ID : | 4160 |
mRNA Refseq : | NM_005912 |
Protein Refseq : | NP_005903 |
MIM : | 155541 |
Uniprot ID : | P32245 |
Chromosome Location : | 18q22 |
Pathway : | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function : | G-protein coupled receptor activity; melanocortin receptor activity; melanocyte-stimulating hormone receptor activity; neuropeptide binding; peptide hormone binding; |
Products Types
◆ Recombinant Protein | ||
MC4R-3266R | Recombinant Rat MC4R Protein, His (Fc)-Avi-tagged | +Inquiry |
MC4R-695H | Recombinant Human MC4R Protein, MYC/DDK-tagged | +Inquiry |
MC4R-5402M | Recombinant Mouse MC4R Protein, His (Fc)-Avi-tagged | +Inquiry |
Mc4r-3987M | Recombinant Mouse Mc4r Protein, Myc/DDK-tagged | +Inquiry |
MC4R-3610R | Recombinant Rat MC4R Protein | +Inquiry |
◆ Assay kits | ||
Kit-1376 | MC4R U2OS β-Arrestin GPCR Assay Kit | +Inquiry |
Kit-1375 | cAMP MC4R CHO-K1 GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MC4R Products
Required fields are marked with *
My Review for All MC4R Products
Required fields are marked with *
0
Inquiry Basket