"MC4R" Related Products

Expand
Expand

Recombinant Human MC4R

Cat.No.: MC4R-29453TH
Product Overview: Recombinant fragment corresponding to amino acids 1-43 of Human MC4 Receptor with a proprietary tag; Predicted MWt 30.36 kDa including tag.
Description: The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity.
Protein length: 43 amino acids
Molecular Weight: 30.360kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Brain, placental, and gut tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: MC4R melanocortin 4 receptor [ Homo sapiens ]
Official Symbol: MC4R
Synonyms: MC4R; melanocortin 4 receptor; melanocortin receptor 4;
Gene ID: 4160
mRNA Refseq: NM_005912
Protein Refseq: NP_005903
MIM: 155541
Uniprot ID: P32245
Chromosome Location: 18q22
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function: G-protein coupled receptor activity; melanocortin receptor activity; melanocyte-stimulating hormone receptor activity; neuropeptide binding; peptide hormone binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.