Recombinant Human MED7
Cat.No. : | MED7-26939TH |
Product Overview : | Recombinant Full Length Human CRSP9 produced in Saccharomyces cerevisiae; amino acids 1-233; 233 amino acids, MWt 27.2 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
Description : | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKD SYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKEL RKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLF VHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKH LERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDS NNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNER P |
Gene Name : | MED7 mediator complex subunit 7 [ Homo sapiens ] |
Official Symbol : | MED7 |
Synonyms : | MED7; mediator complex subunit 7; cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa , CRSP9; mediator of RNA polymerase II transcription subunit 7; CRSP33; |
Gene ID : | 9443 |
mRNA Refseq : | NM_001100816 |
Protein Refseq : | NP_001094286 |
MIM : | 605045 |
Uniprot ID : | O43513 |
Chromosome Location : | 5q33.3 |
Pathway : | Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem; |
Function : | RNA polymerase II transcription cofactor activity; transcription coactivator activity; |
Products Types
◆ Recombinant Protein | ||
MED7-5462M | Recombinant Mouse MED7 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED7-1910H | Recombinant Human MED7 Protein, GST-tagged | +Inquiry |
MED7-9706M | Recombinant Mouse MED7 Protein | +Inquiry |
MED7-10132Z | Recombinant Zebrafish MED7 | +Inquiry |
◆ Lysates | ||
MED7-4379HCL | Recombinant Human MED7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket