Recombinant Full Length Human MED7 Protein, GST-tagged
Cat.No. : | MED7-2110HF |
Product Overview : | Human CRSP9 full-length ORF ( AAH05250, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 233 amino acids |
Description : | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 51.37 kDa |
AA Sequence : | MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MED7 mediator complex subunit 7 [ Homo sapiens ] |
Official Symbol | MED7 |
Synonyms | MED7; mediator complex subunit 7; cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa , CRSP9; mediator of RNA polymerase II transcription subunit 7; CRSP33; CRSP complex subunit 9; transcriptional coactivator CRSP33; activator-recruited cofactor 34 kDa component; cofactor required for Sp1 transcriptional activation subunit 9; RNA polymerase transcriptional regulation mediator subunit 7 homolog; cofactor required for Sp1 transcriptional activation, subunit 9 (33kD); cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa; ARC34; CRSP9; MGC12284 |
Gene ID | 9443 |
mRNA Refseq | NM_001100816 |
Protein Refseq | NP_001094286 |
MIM | 605045 |
UniProt ID | O43513 |
◆ Recombinant Proteins | ||
MED7-2110HF | Recombinant Full Length Human MED7 Protein, GST-tagged | +Inquiry |
MED7-9706M | Recombinant Mouse MED7 Protein | +Inquiry |
MED7-5462M | Recombinant Mouse MED7 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED7-26939TH | Recombinant Human MED7 | +Inquiry |
MED7-1910H | Recombinant Human MED7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED7-4379HCL | Recombinant Human MED7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED7 Products
Required fields are marked with *
My Review for All MED7 Products
Required fields are marked with *