Recombinant Full Length Human MED7 Protein, GST-tagged

Cat.No. : MED7-2110HF
Product Overview : Human CRSP9 full-length ORF ( AAH05250, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 233 amino acids
Description : The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 51.37 kDa
AA Sequence : MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MED7 mediator complex subunit 7 [ Homo sapiens ]
Official Symbol MED7
Synonyms MED7; mediator complex subunit 7; cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa , CRSP9; mediator of RNA polymerase II transcription subunit 7; CRSP33; CRSP complex subunit 9; transcriptional coactivator CRSP33; activator-recruited cofactor 34 kDa component; cofactor required for Sp1 transcriptional activation subunit 9; RNA polymerase transcriptional regulation mediator subunit 7 homolog; cofactor required for Sp1 transcriptional activation, subunit 9 (33kD); cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa; ARC34; CRSP9; MGC12284
Gene ID 9443
mRNA Refseq NM_001100816
Protein Refseq NP_001094286
MIM 605045
UniProt ID O43513

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED7 Products

Required fields are marked with *

My Review for All MED7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon