Recombinant Human MED7

Cat.No. : MED7-26939TH
Product Overview : Recombinant Full Length Human CRSP9 produced in Saccharomyces cerevisiae; amino acids 1-233; 233 amino acids, MWt 27.2 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-233 a.a.
Description : The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKD SYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKEL RKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLF VHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKH LERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDS NNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNER P
Full Length : Full L.
Gene Name MED7 mediator complex subunit 7 [ Homo sapiens ]
Official Symbol MED7
Synonyms MED7; mediator complex subunit 7; cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa , CRSP9; mediator of RNA polymerase II transcription subunit 7; CRSP33;
Gene ID 9443
mRNA Refseq NM_001100816
Protein Refseq NP_001094286
MIM 605045
Uniprot ID O43513
Chromosome Location 5q33.3
Pathway Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem;
Function RNA polymerase II transcription cofactor activity; transcription coactivator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED7 Products

Required fields are marked with *

My Review for All MED7 Products

Required fields are marked with *

0
cart-icon
0
compare icon