"MEF2C" Related Products

Recombinant Human MEF2C

Cat.No.: MEF2C-29558TH
Product Overview: Recombinant full length Human MEF2C with N terminal proprietary tag, 77.66kDa inclusive of tag.
Description: This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe mental retardation, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described.
Protein length: 469 amino acids
Molecular Weight: 77.660kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in brain and skeletal muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCD CEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEQHES RTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYR KINEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLV YSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNT GGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNK NMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDV DLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYP SAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQ QHLHNMQPSALSQLGACTSTHLSQSSNLSLPSTQSLNI KSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSS YDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLS E
Sequence Similarities: Belongs to the MEF2 family.Contains 1 MADS-box domain.Contains 1 Mef2-type DNA-binding domain.
Gene Name: MEF2C myocyte enhancer factor 2C [ Homo sapiens ]
Official Symbol: MEF2C
Synonyms: MEF2C; myocyte enhancer factor 2C; myocyte-specific enhancer factor 2C;
Gene ID: 4208
mRNA Refseq: NM_001131005
Protein Refseq: NP_001124477
MIM: 600662
Uniprot ID: Q06413
Chromosome Location: 5q14
Pathway: Activated TLR4 signalling, organism-specific biosystem; Adipogenesis, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function: AT DNA binding; DNA binding; DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; RNA polymerase II core promoter sequence-specific DNA b;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.