"METTL1" Related Products

Expand
Expand

Recombinant Human METTL1, His-tagged

Cat.No.: METTL1-29205TH
Product Overview: Recombinant full length Human METTL1 with N terminal His tag; 296 amino acids with tag; Predicted MWt 33.6 kDa.
Description: This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.
Protein length: 276 amino acids
Conjugation: HIS
Molecular Weight: 33.600kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
Gene Name: METTL1 methyltransferase like 1 [ Homo sapiens ]
Official Symbol: METTL1
Synonyms: METTL1; methyltransferase like 1; C12orf1, methyltransferase like 1; tRNA (guanine-N(7)-)-methyltransferase; TRM8;
Gene ID: 4234
mRNA Refseq: NM_005371
Protein Refseq: NP_005362
MIM: 604466
Uniprot ID: Q9UBP6
Chromosome Location: 12q13
Function: methyltransferase activity; protein binding; tRNA (guanine-N7-)-methyltransferase activity; contributes_to tRNA (guanine-N7-)-methyltransferase activity; tRNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.