Recombinant Human METTL1 Protein, GST-tagged
Cat.No. : | METTL1-4411H |
Product Overview : | Human METTL1 full-length ORF ( NP_005362.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq |
Molecular Mass : | 57.9 kDa |
AA Sequence : | MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL1 methyltransferase like 1 [ Homo sapiens ] |
Official Symbol | METTL1 |
Synonyms | METTL1; methyltransferase like 1; C12orf1, methyltransferase like 1; tRNA (guanine-N(7)-)-methyltransferase; TRM8; D1075-like gene product; methyltransferase-like 1; tRNA(m7G46)-methyltransferase; methyltransferase-like protein 1; tRNA (guanine(46)-N(7))-methyltransferase; C12orf1; YDL201w; FLJ95748; |
Gene ID | 4234 |
mRNA Refseq | NM_005371 |
Protein Refseq | NP_005362 |
MIM | 604466 |
UniProt ID | Q9UBP6 |
◆ Recombinant Proteins | ||
METTL1-866H | Recombinant Human METTL1 protein, His-tagged | +Inquiry |
METTL1-953H | Recombinant Human METTL1, His-tagged, 33.6kDa (296aa) | +Inquiry |
METTL1-946H | Recombinant Human METTL1 Protein, MYC/DDK-tagged | +Inquiry |
METTL1-4411H | Recombinant Human METTL1 Protein, GST-tagged | +Inquiry |
METTL1-9745M | Recombinant Mouse METTL1 Protein | +Inquiry |
◆ Native Proteins | ||
METTL1-29205TH | Recombinant Full Length Human METTL1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL1-1080HCL | Recombinant Human METTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL1 Products
Required fields are marked with *
My Review for All METTL1 Products
Required fields are marked with *