Recombinant Human METTL1 Protein, GST-tagged

Cat.No. : METTL1-4411H
Product Overview : Human METTL1 full-length ORF ( NP_005362.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq
Molecular Mass : 57.9 kDa
AA Sequence : MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name METTL1 methyltransferase like 1 [ Homo sapiens ]
Official Symbol METTL1
Synonyms METTL1; methyltransferase like 1; C12orf1, methyltransferase like 1; tRNA (guanine-N(7)-)-methyltransferase; TRM8; D1075-like gene product; methyltransferase-like 1; tRNA(m7G46)-methyltransferase; methyltransferase-like protein 1; tRNA (guanine(46)-N(7))-methyltransferase; C12orf1; YDL201w; FLJ95748;
Gene ID 4234
mRNA Refseq NM_005371
Protein Refseq NP_005362
MIM 604466
UniProt ID Q9UBP6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METTL1 Products

Required fields are marked with *

My Review for All METTL1 Products

Required fields are marked with *

0
cart-icon