"MGAT1" Related Products

Expand
Expand

Recombinant Human MGAT1

Cat.No.: MGAT1-29206TH
Product Overview: Recombinant fragment of Human MGAT1 with an N terminal proprietary tag; Predicted MWt 36.41 kDa.
Description: There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. UDP-N-acetylglucosamine:alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I is a medial-Golgi enzyme essential for the synthesis of hybrid and complex N-glycans. The protein, encoded by a single exon, shows typical features of a type II transmembrane protein. The protein is believed to be essential for normal embryogenesis. Several variants encoding the same protein have been found for this gene.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Appears to be present in all tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPPTWEGYDPSWN
Sequence Similarities: Belongs to the glycosyltransferase 13 family.
Gene Name: MGAT1 mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [ Homo sapiens ]
Official Symbol: MGAT1
Synonyms: MGAT1; mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase; GLYT1, MGAT; alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase; GLCNAC TI; GNT 1;
Gene ID: 4245
mRNA Refseq: NM_001114617
Protein Refseq: NP_001108089
MIM: 160995
Uniprot ID: P26572
Chromosome Location: 5
Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem;
Function: acetylglucosaminyltransferase activity; alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.