"MN1" Related Products

Recombinant Human MN1

Cat.No.: MN1-28419TH
Product Overview: Recombinant fragment of Human MN1 with an N terminal proprietary tag; Predicted MWt 37.62 kDa.
Description: Meningioma 1 (MN1) contains two sets of CAG repeats. It is disrupted by a balanced translocation (4;22) in a meningioma, and its inactivation may contribute to meningioma 32 pathogenesis.
Protein length: 109 amino acids
Molecular Weight: 37.620kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitously expressed. Highest levels in skeletal muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: STIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKA KPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGD AKARASVPTWRSLHSDISNRFGTFVAALT
Gene Name: MN1 meningioma (disrupted in balanced translocation) 1 [ Homo sapiens ]
Official Symbol: MN1
Synonyms: MN1; meningioma (disrupted in balanced translocation) 1; meningioma chromosome region , MGCR; probable tumor suppressor protein MN1; MGCR1; MGCR1 PEN;
Gene ID: 4330
mRNA Refseq: NM_002430
Protein Refseq: NP_002421
MIM: 156100
Uniprot ID: Q10571
Chromosome Location: 22q12.1
Function: binding; molecular_function;
Products Types ◆ Recombinant Protein

Related Gene
MN1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.