Recombinant Human MN1
| Cat.No. : | MN1-28419TH |
| Product Overview : | Recombinant fragment of Human MN1 with an N terminal proprietary tag; Predicted MWt 37.62 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | Meningioma 1 (MN1) contains two sets of CAG repeats. It is disrupted by a balanced translocation (4;22) in a meningioma, and its inactivation may contribute to meningioma 32 pathogenesis. |
| Protein length : | 109 amino acids |
| Molecular Weight : | 37.620kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Ubiquitously expressed. Highest levels in skeletal muscle. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | STIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKA KPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGD AKARASVPTWRSLHSDISNRFGTFVAALT |
| Gene Name : | MN1 meningioma (disrupted in balanced translocation) 1 [ Homo sapiens ] |
| Official Symbol : | MN1 |
| Synonyms : | MN1; meningioma (disrupted in balanced translocation) 1; meningioma chromosome region , MGCR; probable tumor suppressor protein MN1; MGCR1; MGCR1 PEN; |
| Gene ID : | 4330 |
| mRNA Refseq : | NM_002430 |
| Protein Refseq : | NP_002421 |
| MIM : | 156100 |
| Uniprot ID : | Q10571 |
| Chromosome Location : | 22q12.1 |
| Function : | binding; molecular_function; |
Products Types
| ◆ Recombinant Protein | ||
| MN1-5442H | Recombinant Human MN1 Protein, GST-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
