Recombinant Human MRE11A

• Cat.No.: MRE11A-28636TH
• Product Overview: Recombinant full length Human Mre11 protein with an N terminal proprietary tag; predicted MWt: 48.77 kDa inclusive of tag.

Specification

• Description: This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3 to 5 exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3 to 5 exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
• Protein length: 206 amino acids
• Molecular Weight: 48.770kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTL DEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLR KYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISI PVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVE KIDISPVLLQKGRTKIALYGLGSIPDERLYRMFVNKKVTM LRPKED
• Sequence Similarities: Belongs to the MRE11/RAD32 family.

Gene Information

• Gene Name: MRE11A MRE11 meiotic recombination 11 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: MRE11A
• Synonyms: MRE11A; MRE11 meiotic recombination 11 homolog A (S. cerevisiae); meiotic recombination (S. cerevisiae) 11 homolog A , MRE11; double-strand break repair protein MRE11A; AT like disease; ATLD
• Gene ID: 4361
• mRNA Refseq: NM_005590
• Protein Refseq: NP_005581
• MIM: 600814
• Uniprot ID: P49959
• Chromosome Location: 11q21
• Pathway: Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA damage response, organism-specific biosystem
• Function: 3-5 exonuclease activity; contributes_to ATP-dependent DNA helicase activity; contributes_to DNA binding; double-stranded DNA binding; endodeoxyribonuclease activity