Recombinant Human MRE11A
| Cat.No. : | MRE11A-28636TH |
| Product Overview : | Recombinant full length Human Mre11 protein with an N terminal proprietary tag; predicted MWt: 48.77 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 206 amino acids |
| Description : | This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3 to 5 exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3 to 5 exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms. |
| Molecular Weight : | 48.770kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTL DEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLR KYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISI PVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVE KIDISPVLLQKGRTKIALYGLGSIPDERLYRMFVNKKVTM LRPKED |
| Sequence Similarities : | Belongs to the MRE11/RAD32 family. |
| Gene Name | MRE11A MRE11 meiotic recombination 11 homolog A (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | MRE11A |
| Synonyms | MRE11A; MRE11 meiotic recombination 11 homolog A (S. cerevisiae); meiotic recombination (S. cerevisiae) 11 homolog A , MRE11; double-strand break repair protein MRE11A; AT like disease; ATLD; |
| Gene ID | 4361 |
| mRNA Refseq | NM_005590 |
| Protein Refseq | NP_005581 |
| MIM | 600814 |
| Uniprot ID | P49959 |
| Chromosome Location | 11q21 |
| Pathway | Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA damage response, organism-specific biosystem; |
| Function | 3-5 exonuclease activity; contributes_to ATP-dependent DNA helicase activity; contributes_to DNA binding; double-stranded DNA binding; endodeoxyribonuclease activity; |
| ◆ Recombinant Proteins | ||
| MRE11A-5537H | Recombinant Human MRE11A Protein, GST-tagged | +Inquiry |
| MRE11A-3748R | Recombinant Rat MRE11A Protein | +Inquiry |
| MRE11A-28636TH | Recombinant Human MRE11A | +Inquiry |
| MRE11A-6354HF | Recombinant Full Length Human MRE11A Protein, GST-tagged | +Inquiry |
| Mre11a-4136M | Recombinant Mouse Mre11a Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRE11A-4211HCL | Recombinant Human MRE11A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRE11A Products
Required fields are marked with *
My Review for All MRE11A Products
Required fields are marked with *



