"MTHFS" Related Products

Expand
Expand

Recombinant Human MTHFS, His-tagged

Cat.No.: MTHFS-30253TH
Product Overview: Recombinant full length Human MTHFS with an N terminal His tag; 223 amino acids with tag, Predicted MWt 25.4 kDa.
Description: The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene.
Protein length: 203 amino acids
Conjugation: HIS
Molecular Weight: 25.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
Sequence Similarities: Belongs to the 5-formyltetrahydrofolate cyclo-ligase family.
Gene Name: MTHFS 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) [ Homo sapiens ]
Official Symbol: MTHFS
Synonyms: MTHFS; 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase); 5-formyltetrahydrofolate cyclo-ligase; HsT19268;
Gene ID: 10588
mRNA Refseq: NM_001199758
Protein Refseq: NP_001186687
MIM: 604197
Uniprot ID: P49914
Chromosome Location: 15q24.3
Pathway: Metabolic pathways, organism-specific biosystem; One Carbon Metabolism, organism-specific biosystem; One carbon pool by folate, organism-specific biosystem; One carbon pool by folate, conserved biosystem;
Function: 5-formyltetrahydrofolate cyclo-ligase activity; 5-formyltetrahydrofolate cyclo-ligase activity; ATP binding; folic acid binding; ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.