"MYBPH" Related Products

Expand

Recombinant Human MYBPH

Cat.No.: MYBPH-26960TH
Product Overview: Recombinant full length Human MYBPH with N-terminal proprietary tag.Mol Wt 78.58 kDa inclusive of tag.
Protein length: 477 amino acids
Molecular Weight: 78.580kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Skeletal muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTR EEQVPKPQAPAPQAPTASTATKPAPPSEDVPSAPLLLTLD DVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPV SARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLD QPIHIRENIEAPKIRVPRHLRQTYIRQVGETVNLQIPFQG KPKPQATWTHNGHALDSQRVSMRTGDQDSILFIRSAQRSD SGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWG CNAALQWTPPQDTGNTELLGYMVQKADKKTGQWFTVLERY HPTTCTISDLIIGNSYSFRVFSENLCGLSTSATVTKELAH IQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQ LFCSVRASPKPKIIWMKNKMEIQGNPKYRALSEQGVCTLE IRKPSPFDSGVYTCKAINVLGEASVDCRLEVKASAAH
Sequence Similarities: Belongs to the immunoglobulin superfamily. MyBP family.Contains 2 fibronectin type-III domains.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name: MYBPH myosin binding protein H [ Homo sapiens ]
Official Symbol: MYBPH
Synonyms: MYBPH; myosin binding protein H; myosin-binding protein H;
Gene ID: 4608
mRNA Refseq: NM_004997
Protein Refseq: NP_004988
MIM: 160795
Uniprot ID: Q13203
Chromosome Location: 1q32.1
Pathway: G13 Signaling Pathway, organism-specific biosystem;
Function: structural constituent of muscle;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.