"MYO7B" Related Products

Recombinant Human MYO7B

Cat.No.: MYO7B-29760TH
Product Overview: Recombinant fragment of Human MYO7B with N-terminal proprietary tag. Predicted MW 36.30 kDa.
Protein length: 97 amino acids
Molecular Weight: 36.300kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFT
Sequence Similarities: Contains 2 FERM domains.Contains 6 IQ domains.Contains 1 myosin head-like domain.Contains 3 MyTH4 domains.Contains 2 SH3 domains.
Gene Name: MYO7B myosin VIIB [ Homo sapiens ]
Official Symbol: MYO7B
Synonyms: MYO7B; myosin VIIB; myosin-VIIb;
Gene ID: 4648
mRNA Refseq: NM_001080527
Protein Refseq: NP_001073996
MIM: 606541
Uniprot ID: Q6PIF6
Chromosome Location: 2q21.1
Function: ATP binding; actin binding; motor activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.